(data stored in ACNUC7421 zone)

EMBL: CP001402.PE249

CP001402.PE249       Location/Qualifiers
FT   CDS_pept        213348..214334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0251"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40885"
FT                   /db_xref="GOA:C4KKE4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKE4"
FT                   /protein_id="ACR40885.1"
FT                   /translation="MLAAILRSFGEELSLEDVREPSNGIILKVLATGLCHGDLHVMNGD
FT                   WKYEIKIELPKILGHEIVGEVVKGNHNFKEGDKVLVYNSVGCGKCKYCVSRKYQYCEKV
FT                   KIVGLNIDGGFAEYVSVPTDNILLRVDGNPVELAPLADAGITAYSSTKGIGEGDNVLII
FT                   GTGAVALLALQILKLKGARITVIGHNKNKLGKAKEIGADEVIDIQDGSTIASEIKESKF
FT                   DYIIDYVGSDYTLSDSMWLLNREGELRIVGEFGGTLTVPEQLLVLKGLKVRGILYGSFD
FT                   DLISVYKLYNEGKIRPIVNTYRLRDINKSIKGLREGKMIGRAVIVPP"
     atgctagctg cgattctaag aagtttcggt gaggaattaa gtctcgaaga tgtaagagag        60
     ccttccaatg gaattattct aaaagttcta gctactgggc tttgtcatgg ggacttgcat       120
     gtaatgaatg gcgattggaa atacgaaatc aagattgaat taccgaaaat attaggacat       180
     gaaattgtcg gcgaagttgt taaaggcaat cacaatttta aggaagggga taaggtacta       240
     gtttataata gtgttggttg tggaaaatgt aagtattgtg tgtccagaaa gtatcaatac       300
     tgcgaaaaag tgaaaattgt tgggcttaat attgatggtg gtttcgcgga atatgtgagt       360
     gttcctactg ataatattct cttaagagta gatggtaatc ccgttgagtt agcgccccta       420
     gcagatgccg gaataacagc ttatagctca accaagggca taggtgaggg ggataatgta       480
     ttaattattg gaactggggc tgtcgcacta ttggcattac aaattttaaa actaaaagga       540
     gctagaatta ccgttattgg gcataataaa aataagcttg gtaaggcgaa ggaaatagga       600
     gctgatgagg taattgatat acaagatggc agtacgatag ctagtgagat taaggagtct       660
     aagtttgatt acattataga ttacgtgggc agtgattaca cactttctga ttccatgtgg       720
     ttgctaaata gggaaggaga gctaagaatt gtcggagaat ttggtggtac tctaactgtt       780
     ccggagcagt tactagtatt aaaggggtta aaagtaaggg gtatattata cggcagcttt       840
     gatgatttga taagtgttta taaactatat aatgagggaa aaattagacc tatagtaaat       900
     acgtacagat taagggatat caacaagtcg attaagggtt taagagaggg caaaatgata       960
     ggccgtgcag tcatagtgcc tccttaa                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page