(data stored in ACNUC7421 zone)

EMBL: CP001402.PE25

CP001402.PE25        Location/Qualifiers
FT   CDS_pept        complement(22729..23460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0025"
FT                   /product="protein of unknown function DUF91"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40661"
FT                   /db_xref="GOA:C4KJE1"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJE1"
FT                   /protein_id="ACR40661.1"
FT                   /translation="MRISNTVYSVLLNPSNTEIYSFLTERIYRELVVIFATCKVNYKGR
FT                   AESVASESPRLIILKPDGTVIIHESVKREPLNWQPPGTKIEIMNDYPLKIVAQRKRPKE
FT                   VIEIDLKEVFYITSAEVKDGDFVIKGREIDIVNTIIQNPSMIEEGFVPLTREYNTPYGK
FT                   IDLVGLDKKGNFVIIEVKRSKAQLSAVSQLYRYYLHIRETKEDKVRGILVAPDLTTHAR
FT                   ELLQKLGLEFIRYDIQKYSSY"
     ttgaggataa gtaatactgt gtactcggta ctactgaatc ctagcaatac ggaaatttat        60
     tccttcttaa cagagagaat ttatagagaa ctagtagtaa tcttcgctac atgtaaggtg       120
     aattataagg gaagagctga atcagtagcc tcggaatctc ctaggttaat aatattgaaa       180
     ccggatggta cagtgataat acatgaaagt gtgaaaaggg aaccgttaaa ctggcaacca       240
     ccaggaacta aaatagagat aatgaatgat tatccattga agatagtagc tcaaagaaaa       300
     agaccaaaag aagtaataga gatagatttg aaagaagtat tttatataac gtcagctgaa       360
     gtaaaggatg gggatttcgt gattaaagga agagagattg acatagtaaa tactattatt       420
     caaaatccca gtatgatcga agaagggttt gtcccattaa ccagagagta taatacacct       480
     tatgggaaaa tagatctggt ggggttagat aaaaaaggta atttcgtaat aattgaagta       540
     aagagaagta aagctcaatt aagtgcagtc tcacaattat atagatacta cttacacata       600
     agagaaacaa aagaagacaa ggtaagaggg atactcgtag ctccggattt aactactcat       660
     gcaagagaac tattacaaaa attagggctt gagtttatca gatacgacat acagaagtat       720
     tctagttact ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page