(data stored in ACNUC7421 zone)

EMBL: CP001402.PE250

CP001402.PE250       Location/Qualifiers
FT   CDS_pept        complement(214331..214570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0252"
FT                   /product="50S ribosomal protein L13e"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40886"
FT                   /db_xref="GOA:C4KKE5"
FT                   /db_xref="InterPro:IPR001380"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KKE5"
FT                   /protein_id="ACR40886.1"
FT                   /translation="MEFPKALIKRPNYHFEYPHKRKDKRIGRGFSIGELEKAGLNINNA
FT                   RKLGIIVDIRRKSVHEENVEVLKKFLEQLSNQKS"
     atggagttcc ctaaagcttt aataaaaaga ccaaattatc atttcgaata cccacataaa        60
     agaaaggata aaagaatagg tagaggattt agtataggag aacttgaaaa agccggctta       120
     aatataaata acgctagaaa actggggata atagtagata taagaagaaa atcggttcat       180
     gaagaaaatg tagaggtact aaagaagttt ttagagcaac tttcaaatca aaaatcttaa       240
//

If you have problems or comments...

PBIL Back to PBIL home page