(data stored in ACNUC7421 zone)

EMBL: CP001402.PE252

CP001402.PE252       Location/Qualifiers
FT   CDS_pept        215630..216073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0254"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40888"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKE7"
FT                   /protein_id="ACR40888.1"
FT                   /translation="MKIKLKSLAKVVGEEELAVIPLAENEYFIECLNFYEDVEGGRQAR
FT                   LVVIVDKYGIIRQDQVNFIKGKKTFVDAIGIEDDFRKIQSVLKLDRIARMFKVPLYFDV
FT                   EIIEKPDVSKRGIKGFYNYLSVHKEIDMSKLKGLVSLSIEELV"
     ttgaagatca aattaaagtc tcttgcaaag gttgttggag aagaggaatt agcagtaata        60
     cctttagctg aaaatgaata ttttatagaa tgtctaaatt tttatgaaga tgtagaagga       120
     ggaagacaag ctagattggt tgttatagta gataaatatg gaataataag acaagatcaa       180
     gttaatttta taaaaggtaa aaagacattt gttgacgcta taggaataga ggatgatttc       240
     agaaaaatac aaagtgtgtt gaagctggat agaatagcta gaatgtttaa agttccatta       300
     tattttgatg tcgaaataat tgagaaacca gatgtttcta agaggggaat aaaaggattt       360
     tataactatt tgtcagttca taaggaaata gatatgagta agttgaaggg tttagtaagt       420
     ttaagtatcg aagaacttgt ctaa                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page