(data stored in ACNUC7421 zone)

EMBL: CP001402.PE254

CP001402.PE254       Location/Qualifiers
FT   CDS_pept        complement(217105..217956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0256"
FT                   /product="PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40890"
FT                   /db_xref="GOA:C4KKS5"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKS5"
FT                   /protein_id="ACR40890.1"
FT                   /translation="MIHLAVGRFNIDIIVKLDSIPPIDSSHMTDVLEIMPGGAATNYAV
FT                   AVTKLGHSAKLLAKVGKSEVVRSLMEKVVELGVGLEYVEELNEKPSATLIFLRSDGTLS
FT                   MVRRLGASILLTREDVKRRFGLFDVIHFASVSPNVVVRDPYAKLVSYDPGPQAKNIESI
FT                   DVDILYINEKEYEMIEGKNIKARFIVIKMGKKGAKIITETEECSVEPIQVEKVVDTTGA
FT                   GDTFDAAFNVTYSEEKDIIKSLQVASVASGLKVTKIGGISSPTLEEVREYLRKKKPNVI
FT                   CK"
     ttgatacacc tagcagtggg gagatttaac attgatatta tagtaaaatt ggattctatt        60
     ccacctatag attccagtca tatgacggat gttcttgaaa tcatgcccgg aggagctgca       120
     acaaactatg cagtggctgt gactaaactg ggtcactctg ctaaactatt agcaaaggtt       180
     gggaaaagcg aagtagttag aagtctaatg gaaaaagtag tagaattagg ggtaggatta       240
     gaatacgtag aggaattaaa cgagaaacct agtgcaacac taatcttctt gagaagtgat       300
     ggaacactat ctatggtaag aagacttggc gcatcaatat tgctaacaag agaagatgta       360
     aaaaggcgtt ttggattgtt tgacgttatt cacttcgcct cagtatcacc aaacgttgtt       420
     gtgagagatc cttatgcaaa attagtaagc tatgatcctg gcccacaagc taaaaatata       480
     gagtcgattg acgtagacat cttatatatt aatgaaaaag agtatgaaat gatagaaggt       540
     aagaacataa aggctagatt tatcgtcatt aagatgggca agaaaggggc aaagataatt       600
     actgaaactg aagagtgttc agttgaacca atacaagtag aaaaggtagt tgatactacc       660
     ggagctggag atacctttga tgcagcattt aatgtaacat attctgagga aaaggatatt       720
     ataaagagtc tacaggttgc cagcgttgca tctggtctta aggttacgaa gataggagga       780
     atttcttcac caacattaga agaggtacga gaatatttaa ggaagaagaa accaaatgtt       840
     atatgtaaat ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page