(data stored in ACNUC7421 zone)

EMBL: CP001402.PE257

CP001402.PE257       Location/Qualifiers
FT   CDS_pept        complement(220243..221031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0259"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40893"
FT                   /db_xref="GOA:C4KKS8"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR022443"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKS8"
FT                   /protein_id="ACR40893.1"
FT                   /translation="MVSRLSTGILDFDKLIQGGIPQGFFIALTGEPGTGKTIFSLHFIA
FT                   KGLRDGDPCIYVTTEESRDSIIRQAKQFNWDFEEYIEKKLIIIDALMKEKEDQWSLVNL
FT                   TPEELVNKVIEAKQKLGYGKARLVIDSVSALFLDKPAMARKISYYLKRVLNKWNFTIYA
FT                   TSQYAITTSQAFGFGVEHVADGIIRFRRMIRNGELHRYILIEKMRQTDHDKHVWEIDIV
FT                   NGKGIVLKGRLEERREDYTLPEKVKRKIIESGKKTEEELK"
     atggtaagta gactatctac tggaatattg gattttgata aactaataca aggtgggatt        60
     cctcaaggat ttttcatagc gctgactgga gagcctggaa ctggaaagac aatattttca       120
     cttcacttca ttgctaaggg attaagggac ggagatcctt gtatatacgt tacaactgag       180
     gaaagtaggg attcaataat aagacaagct aagcagttta attgggattt tgaggaatat       240
     atagagaaga agttgataat aatagatgca ctaatgaagg aaaaagagga ccaatggtct       300
     ttagtgaact taactcctga agaattagtg aataaggtaa ttgaggctaa acaaaaatta       360
     ggttatggta aagctagatt ggtaattgat tcagtaagtg cattattttt ggataaaccc       420
     gcaatggcaa ggaaaataag ctactatctt aagagagtcc taaataaatg gaatttcaca       480
     atatatgcta cttcacaata cgcaataacc acatcacaag catttggatt tggagtagag       540
     catgtggcag atgggataat cagattcaga aggatgataa ggaatgggga actacatagg       600
     tacatattaa ttgagaaaat gagacaaacc gatcacgata agcatgtatg ggaaatagat       660
     atagttaatg gtaaaggaat agtcttgaag ggaagattag aggaaagaag ggaagattat       720
     acattgccag aaaaggtaaa gagaaagatc attgagagtg gcaaaaagac tgaggaggaa       780
     ttgaagtga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page