(data stored in ACNUC7421 zone)

EMBL: CP001402.PE258

CP001402.PE258       Location/Qualifiers
FT   CDS_pept        221110..221595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0260"
FT                   /product="dual specificity protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40894"
FT                   /db_xref="GOA:C4KKS9"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKS9"
FT                   /protein_id="ACR40894.1"
FT                   /translation="MYWVRRKTIGGSGLPYTENEILEWRKEGVKRVLVLPEDWEIEESW
FT                   GDKDYYLSILKKNGLQPLHIPIQDGGVPSDSQFLTIMRWLLSEKEGNLVHCVGGIGRTG
FT                   TILASYLILTEGLDVESAINEVRLVRPGAVQTYEQEMFLLRVEGMRKSWLKNIYSNS"
     atgtattggg ttagaaggaa aaccatagga ggttctggat taccatatac cgaaaacgag        60
     attttagaat ggaggaaaga aggagtgaaa agagtattag ttttaccaga ggattgggaa       120
     atcgaagaga gttggggaga taaggattat tatctgtcta ttctcaagaa aaatggactt       180
     cagcccttac atattccaat tcaagatggg ggagttccat cagattctca atttcttaca       240
     attatgagat ggctattaag tgaaaaagaa ggtaatctag ttcattgtgt aggtggaata       300
     ggaaggactg gtacaatttt agctagttat ctaattttaa ctgaaggatt ggatgtggaa       360
     tctgctatta acgaagttag attggtaaga cctggtgcag tacaaacata tgagcaagag       420
     atgttcttat tacgtgtgga agggatgaga aagagttggt tgaaaaacat ctactcgaat       480
     tcttag                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page