(data stored in ACNUC7421 zone)

EMBL: CP001402.PE263

CP001402.PE263       Location/Qualifiers
FT   CDS_pept        224496..225635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0265"
FT                   /product="protein of unknown function DUF763"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40899"
FT                   /db_xref="InterPro:IPR008482"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKT4"
FT                   /protein_id="ACR40899.1"
FT                   /translation="MEVEGIADLPLHTGHVPPWLVPIMKRLAKAIVEIMILELGPQKVV
FT                   ERFSNPLWFQGFNNIIGMDWDSSGSTTVTLGILKDITNPKVHGFAVLGGKGKNALKVPD
FT                   EVDMLIFDVDKNKIKNISKIVAKVDSTLVQDGHQLYHHTMLVTEDGKWSIIQQGMNLET
FT                   KFARRYHWKETDNFVVEPHSAISGIKTNVVVNVIDRDKDRTRKLILDLLRENPNKIVSL
FT                   YTQAMAMLKGQSTLDMWIKGGSIAFVSKEARLIYMKPVDVNRIKQVLREMYESNPLTFE
FT                   EALINGLGPSTARALYLIADLIYNEPPSYKDPMNYPYDPFKYAFAIGGKDGIPYPVNRK
FT                   AAWEVIYTLEDFITRAKLEEGDKRLALRKLKELSKGIEK"
     atggaagtag agggaatagc tgacttaccg cttcatactg gtcatgttcc cccgtggtta        60
     gtccccatta tgaaaaggtt agctaaggcc atagttgaaa taatgattct tgaattaggt       120
     cctcaaaagg ttgtagagag gttttcgaat cccttgtggt ttcaaggttt caataacatt       180
     attggaatgg actgggattc ctctggctct acaaccgtaa cattaggtat tttgaaggac       240
     attacaaacc ctaaagttca tggttttgct gtgctgggag gtaaaggcaa aaatgctcta       300
     aaggttccag atgaggtaga tatgttaatt tttgatgtag ataagaataa aattaaaaat       360
     ataagtaaaa tagtagcaaa agttgattca accttggttc aagatggaca tcaactctat       420
     catcacacca tgcttgtaac cgaggacgga aaatggagca taatccagca aggcatgaat       480
     ttagaaacaa agttcgctag gagatatcat tggaaagaga ctgataattt tgtggtagaa       540
     cctcattctg caatatctgg tattaagact aacgttgtag ttaacgtaat agatagagat       600
     aaggatagga cacggaagtt aatattagat ttgctgaggg agaatcccaa taagatagtc       660
     tccttatata ctcaagcgat ggctatgctt aaaggtcaat caactttaga catgtggata       720
     aaaggaggat caatagcgtt cgtatccaaa gaggctagat taatttacat gaagcccgtg       780
     gatgttaata gaatcaaaca agtactaaga gaaatgtatg aatctaaccc acttacattt       840
     gaggaagcac taattaatgg tttaggtccc tccacagcta gggcgttgta cttaatagca       900
     gatctaatat ataacgaacc gccatcttac aaagacccga tgaattatcc ttatgaccca       960
     tttaagtacg catttgctat tggaggtaaa gatggtattc catatccagt taataggaaa      1020
     gctgcttggg aggtgatata taccttagaa gattttataa ctagagctaa gcttgaagaa      1080
     ggcgataaac gattagcctt aaggaagtta aaagaacttt ctaaaggtat tgagaaataa      1140
//

If you have problems or comments...

PBIL Back to PBIL home page