(data stored in ACNUC7421 zone)

EMBL: CP001402.PE264

CP001402.PE264       Location/Qualifiers
FT   CDS_pept        225745..226407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0266"
FT                   /product="protein of unknown function DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40900"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKT5"
FT                   /protein_id="ACR40900.1"
FT                   /translation="MFKLRLNNKEEEVFEKISFTAELIGEAVKILQNEVDHVRKGENDQ
FT                   IPADLIKIKSIHERAGMLREEILSTLYGEAFLPDFKESMVMLAQALFNTLSSVKDAARA
FT                   LGSRKVDLKCVTILSDMLITYLALVNEASLKIHELTRHLGSDVEVSLKLSREIQAMERE
FT                   GDDIKDTLLQRLYEIEKEIDIISILQMKDVIIFIDDILDSLEDATLSVEVFYATLKS"
     atgttcaaat taaggctaaa taataaggaa gaagaggtat ttgagaaaat tagctttact        60
     gcagaactaa taggtgaagc agttaagatt ttgcaaaacg aagtagatca cgtaagaaag       120
     ggtgaaaatg accaaattcc ggcagattta attaaaatta aatctattca cgaaagggct       180
     ggaatgctac gtgaggaaat actttcaact ctttatggag aagcattttt accagacttt       240
     aaggaatcaa tggtaatgtt ggctcaggct ctttttaata ctttgagttc tgtaaaagat       300
     gcggctagag ctttggggtc taggaaagtt gatttgaaat gtgtgacaat tctatcagat       360
     atgttaatta cgtatctggc attggtcaat gaggcatcac ttaagattca cgaactaacg       420
     aggcacctag gatcagatgt tgaagtttca ttaaaattaa gtagggaaat acaagcaatg       480
     gaaagagaag gggatgatat caaggacact cttttgcaga ggctttatga gatagagaag       540
     gagattgata ttataagtat attacaaatg aaagatgtga ttatatttat agacgatata       600
     ttggactcgt tagaagatgc gacactaagt gtggaagtat tttatgctac actaaagtcc       660
     taa                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page