(data stored in ACNUC7421 zone)

EMBL: CP001402.PE267

CP001402.PE267       Location/Qualifiers
FT   CDS_pept        227740..229887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0269"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40903"
FT                   /db_xref="GOA:C4KKT8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR022965"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKT8"
FT                   /protein_id="ACR40903.1"
FT                   /translation="MSLELEWMSIDDLKLPSNVIDIIKNRGIKKLNPPQTEAVKKGLLD
FT                   GNRLLLTSPTGSGKTLIAEMGIISFLLKNGGKAIYVTPLRALTNEKYLTFKDWESIGFK
FT                   VAMTSGDYDTDDAWLKNYDIIITTYEKLDSLWRHRPDWLNEANYFVLDELHYLNDPERG
FT                   PVVESVTIRTKRRNLLALSATISNYKQIAKWLGAEPVATNWRPVPLMEGIMYPEKKKKE
FT                   YTILFRDNTTRKVHGDDAIIAYTLDSLTKNGQVLVFRNSRKMAESTALKIANYMNFVSL
FT                   DEKAISEILNQLDDIEEGGSDEKELLKSLISKGVAYHHAGLSKALRDIIEESFRKRKIK
FT                   VIVATPTLAAGVNLPARTVIIGDIYRFNRKIVGYYDEIPVMEYKQMSGRAGRPGFDQIG
FT                   ESIIVVRDKEDVDRVFKKYILSDVEPIESKLGSERAFYTFLLGILSAEGSLSEKQLEGF
FT                   AYESLLAKSLVDVYFDRAIRWLSEHSFIREENNTFTLTNFGKRVADLYINPFTADIIRK
FT                   GLEGHKASCEIAYLHLLAFTPDGPLVSVGRNEEEELIELLEDLECELLVEEPYEEDEYS
FT                   LYLNALKVALIMKDWIDEVDEDTILGKYNIGSGDLRNIVETMDWLTYSAYHLSKELRLD
FT                   NHSDKLRILNLRVTDGVKEELLELVQIGGVGRKRARLLYNNGIKGLGDVVMNPDRVRNL
FT                   LGQKLGERVVQEAARLLNRFH"
     atgagtttag aattagagtg gatgtcaata gacgacctaa aattacctag taacgttatt        60
     gatataataa aaaatagggg tataaaaaaa cttaacccac ctcaaactga agcggtaaaa       120
     aaaggtctat tagatggaaa tagactacta ttgacttcgc ctactggttc tgggaagaca       180
     ctaatagcag agatgggaat aatttcattt cttctaaaaa acggaggaaa agcaatatat       240
     gtgaccccac ttagggctct tacgaatgaa aagtatttaa cttttaagga ttgggaatca       300
     ataggtttta aagtggctat gacttcaggt gattatgata cagatgatgc ttggttgaag       360
     aattatgata ttataatcac cacttatgaa aagttagatt ccctatggcg tcatagacca       420
     gattggctta atgaggctaa ttatttcgta ttggacgaac tacattacct taacgatcct       480
     gaaagagggc cagtagttga gagcgtcaca ataaggacta aaaggagaaa tctattggca       540
     ttgagtgcta caataagtaa ctataagcaa atagctaaat ggttaggagc agaaccagtg       600
     gcaacgaatt ggagaccagt tcccctcatg gagggtatta tgtatccaga gaagaaaaag       660
     aaggaatata ctatactttt cagagataat actaccagga aggttcatgg agatgacgcc       720
     ataatagctt atactctaga tagtctaacc aaaaatggac aagttttagt ttttaggaat       780
     tccaggaaaa tggcagaaag cacagcatta aagattgcaa attacatgaa ttttgtaagt       840
     ttagatgaga aagccatatc tgagatttta aatcaattgg atgatatcga ggaaggtgga       900
     agtgatgaaa aagagttact aaaatctctt ataagtaagg gagttgcata tcatcacgct       960
     ggactatcaa aggcgttaag ggatataata gaggagagtt tccggaaaag aaaaataaag      1020
     gtgatcgtag caactccaac cttggcagct ggcgtaaatt tacctgctag aacagtaata      1080
     ataggagata tttatcgatt caataggaag atagttggat attacgatga aattccagtt      1140
     atggaatata agcaaatgag cggaagagct ggtagacctg gttttgatca gattggcgag      1200
     tcaataattg tggtaaggga taaggaagac gtagatcgag tatttaagaa atatatacta      1260
     tctgatgttg agcccattga atctaaactg ggtagtgaaa gggcatttta cacgttctta      1320
     ctcggcatac tttctgctga aggtagtctg agtgaaaaac agctggaagg ctttgcatat      1380
     gaatctctgc ttgcaaagtc actagttgac gtttattttg atagggccat aaggtggcta      1440
     tcagagcatt cttttatcag agaggaaaat aatacgttta ctttaactaa ttttggaaag      1500
     agggttgctg atctatatat aaatccattt actgctgaca tcataagaaa ggggcttgag      1560
     ggacataagg cttcgtgtga aatagcttac ctccatttac tagcgtttac tccagatgga      1620
     ccattagtat cagttggaag gaatgaggaa gaagagctaa ttgaattgct ggaagaccta      1680
     gagtgtgagc tgttagtaga ggaaccttat gaggaagacg aatattccct ttacttaaat      1740
     gcgttaaaag tggcgttgat aatgaaggat tggatagatg aagttgatga agataccata      1800
     ttgggtaaat ataacatagg ttctggagat ttgagaaata tcgttgaaac tatggactgg      1860
     ttaacctata gtgcttacca tttatctaaa gagttaaggt tagataatca cagcgataaa      1920
     cttaggatct tgaacttaag agtgactgat ggtgtaaagg aagagctatt agaattagtt      1980
     caaataggtg gtgtaggtag gaagagagct agattattgt acaataacgg aattaaagga      2040
     ctaggtgatg ttgtaatgaa tccagataga gttaggaact tgttaggcca aaagctaggt      2100
     gagagagttg tccaagaggc tgcaagatta cttaatagat ttcattaa                   2148
//

If you have problems or comments...

PBIL Back to PBIL home page