(data stored in ACNUC7421 zone)

EMBL: CP001402.PE269

CP001402.PE269       Location/Qualifiers
FT   CDS_pept        complement(231620..232129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0271"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40905"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKU0"
FT                   /protein_id="ACR40905.1"
FT                   /translation="MRLFRLYSELGDMYLVSYEQSNNSLDKIKIGDKNYEVKYLGPGNR
FT                   ENEYLFEINGKKYYVFIESDGTLIFNHQDFLRLDKVTEIPIKGEERVEEIIRGKEGEIV
FT                   SPLFGRVVKIRVKEGDAVNKGQPLLSIEAMKAETVISSPIGGIVQKILIKEGQGVKKGD
FT                   ILIVIK"
     atgaggttat ttagacttta tagcgaattg ggagatatgt atttagtatc ttatgaacag        60
     agcaacaaca gtcttgataa aataaaaata ggagataaaa actatgaggt aaaatatcta       120
     ggaccaggca atagggaaaa tgagtattta tttgagatta atgggaaaaa atattatgtt       180
     ttcatagagt ccgatggtac tttgatattc aaccatcagg atttcttaag gttagataag       240
     gtaactgaaa ttcccataaa aggagaagaa agagttgagg aaataattag aggaaaggaa       300
     ggagaaattg tatctccatt atttggaagg gtagttaaaa ttagagtaaa ggaaggggat       360
     gcagtaaata agggtcaacc tttattatcc attgaggcaa tgaaggcaga aacggtaatc       420
     tcatcgccaa taggtgggat cgtgcaaaaa attctgatca aggaaggaca aggtgtaaag       480
     aagggagata ttttaattgt tataaaatag                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page