(data stored in ACNUC7421 zone)

EMBL: CP001402.PE27

CP001402.PE27        Location/Qualifiers
FT   CDS_pept        24676..25239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40663"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJE3"
FT                   /protein_id="ACR40663.1"
FT                   /translation="MQSTSVEIYLNIYSFRHELEHFTIEEERDEWSIVKDKANEKYIVK
FT                   EFADYGILIYPVYDLKDDILSSFSIQLPSVGKLKEILYTPEKWIDRLDLRINDNSIEVT
FT                   SLILDYLTGIDIINSLISSFGFQYAQLDDNSLIIKIRISRPLNRTLLDSHIRAIYHMLK
FT                   LYYSVKKAQEEIASKVTLSYIKSI"
     atgcagagta cctcagtgga aatttaccta aacatttatt cgttcaggca tgagctagaa        60
     cactttacca tagaagagga aagggacgag tggtcaatcg taaaagataa agccaatgaa       120
     aagtatattg taaaagagtt tgctgattac ggtattttaa tatatcctgt ttatgatctt       180
     aaagatgata tattatcttc attttccatc cagctcccat cagttggcaa acttaaagaa       240
     attctataca caccagaaaa atggattgat aggttagatt taagaataaa cgataatagt       300
     atagaagtca cttcattaat attagattat ttaaccggaa tagatattat aaactcgttg       360
     atatccagct tcggcttcca atatgcacaa ttagatgata actccttgat tattaaaata       420
     cgcatatcta ggcccttaaa tcgtacttta ttggattccc atattagagc gatttatcat       480
     atgctgaaat tatactacag tgtgaaaaag gcacaagagg aaattgcatc taaggttact       540
     ctaagttata taaaaagcat ataa                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page