(data stored in ACNUC7421 zone)

EMBL: CP001402.PE271

CP001402.PE271       Location/Qualifiers
FT   CDS_pept        complement(234086..235693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0273"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40907"
FT                   /db_xref="GOA:C4KKU2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKU2"
FT                   /protein_id="ACR40907.1"
FT                   /translation="MNEILLIFLASLASLGRVFLTIGLSIITGWFLGYIAIKSKAFENI
FT                   YISVVEIFESVPVISFFPVVLIFFVYRIGGYIGIELAVDFLVFTAVVWNIWIGIYQAFK
FT                   TVPSDLLEVSENYRLGFLGKMAKLYIPYSWPRIAANLIPSFADAIFYITVSEVFSIGSS
FT                   SYHVFGIGTLIGEFTASQEYTLALDGLGILAIPIIIFTYLLRRFANYTVSKYGLDTEIK
FT                   VTKRGRMRIRYATRMSNTIAPFVKLSKYVTRIGSRSASSEEETRRNLPWRYLGIGISVL
FT                   LLGLLVYGAFSTISSVPKSVWLYLISTTPNVLFNLLIDYIRVLFIAIVSLVFSIFLGYF
FT                   IATRERVEKVLIPAIQTYASFPAPAYFPLLFTATISFIHSVFGSWTDEFYVILLGFIST
FT                   FYYVFYSYWLGIKNMPNQYWEIMKNYNFSFWHKLRYVIIPSTFPYIISGLSSTINSAWG
FT                   GLAIGEYWEISNSYTLQVSHGIMKSIAVATANGNIPLAAWDSLIFGIVVMIYSIFFTRK
FT                   MMDLAREKYVAEEGIYLA"
     atgaatgaga ttttgctgat atttttggcc tctctagcat cattaggtag ggtttttctt        60
     acaataggat tgtcaataat taccgggtgg tttctagggt atatagcaat aaaaagtaag       120
     gcgtttgaaa atatctatat ttcagttgta gaaattttcg aatcagttcc agttatttca       180
     ttctttccag ttgttctaat attctttgta tataggattg gtggatatat cggtatagaa       240
     ttagccgtgg attttctagt tttcactgct gtagtatgga atatatggat agggatatat       300
     caggctttca agactgttcc gagcgacctt ttagaagtta gtgaaaacta tagattaggc       360
     tttctaggta aaatggcaaa actatatatc ccttattcat ggcctagaat agcggctaac       420
     cttataccca gtttcgctga cgcgatcttc tatattaccg ttagtgaggt tttctccata       480
     ggcagttcta gttaccacgt atttggtata ggtacattaa ttggggagtt tactgcatcg       540
     caagagtata ctctagcctt agatggatta ggaattcttg caattcctat aattatattt       600
     acatatttat taagaagatt tgccaactat acagtgtcta aatatgggtt agacactgaa       660
     ataaaagtaa ccaaaagagg tagaatgaga ataagatatg ccacgagaat gtcaaacaca       720
     atagctcctt ttgtcaagtt atctaaatat gtgacgagaa ttggaagcag aagcgcaagt       780
     agcgaagagg agactagaag gaacttacct tggagatatt tgggcattgg aatctcggta       840
     cttttattgg gattattagt ttatggggct ttctccacaa tttcctcagt acctaaatcg       900
     gtatggcttt acttaatctc aaccactccc aacgttcttt tcaacctttt aatagactac       960
     ataagagttc ttttcattgc aattgttagt ctagtattct caatatttct aggatatttc      1020
     atcgcaactc gtgaaagagt agaaaaagta ttaatcccgg caatacaaac atatgcgtct      1080
     tttccagctc cagcctactt tccattactt tttacagcta ccattagttt tattcatagt      1140
     gtatttggaa gttggactga tgaattttac gtaatacttt taggtttcat atcaactttc      1200
     tattacgttt tctatagtta ttggcttggg ataaagaaca tgcctaatca atactgggag      1260
     ataatgaaaa actataattt ctccttctgg cataagttaa gatatgtaat tataccttca      1320
     acatttccat atataatttc aggactttcc agcacgataa atagtgcatg gggaggtttg      1380
     gcaataggag aatattggga aatttcaaac agttacacat tgcaagtcag ccatggtatt      1440
     atgaagagta ttgcagtagc tactgcaaat ggaaatatcc ctcttgcagc atgggactcg      1500
     ttaatatttg gaatagtagt aatgatttac tcaatatttt tcacgagaaa aatgatggat      1560
     ttagcaaggg agaaatacgt tgcagaggaa ggaatttatt tagcatga                   1608
//

If you have problems or comments...

PBIL Back to PBIL home page