(data stored in ACNUC7421 zone)

EMBL: CP001402.PE273

CP001402.PE273       Location/Qualifiers
FT   CDS_pept        complement(236526..236765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40909"
FT                   /db_xref="GOA:C4KKU4"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKU4"
FT                   /protein_id="ACR40909.1"
FT                   /translation="MKWIIIGMVSLLLTIVDYRIGIESVKLVYGYAVYQLLTTMPFNVV
FT                   YLCLIFLIELLIINSFLKLRRIFNIFRHKDKSPM"
     gtgaagtgga ttattatcgg tatggtctcc ctactgctta cgatcgttga ttataggatt        60
     ggaatagaga gtgttaaact cgtttatgga tatgcagtat accaactttt aactacaatg       120
     ccatttaatg ttgtatatct ttgtttgatt tttctaatag aattattaat aataaattcg       180
     tttttaaaat taagaagaat tttcaatatt tttcgtcata aagataaatc cccaatgtag       240
//

If you have problems or comments...

PBIL Back to PBIL home page