(data stored in ACNUC7421 zone)

EMBL: CP001402.PE274

CP001402.PE274       Location/Qualifiers
FT   CDS_pept        complement(236799..237296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0276"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40910"
FT                   /db_xref="GOA:C4KKU5"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KKU5"
FT                   /protein_id="ACR40910.1"
FT                   /translation="MIIEGPVIKFGDKIDTDIIIPARYLKYTDPQYLAQHAMEPLDPEF
FT                   YKKASKGVIIVAGKVFGMGSSREQAAIALKAAGVKAVVAESFARIFYRNAINNGLPVIT
FT                   LPNSTKEIDENSYVKIDVETGEILVGNKVLKGKGITGMALEILQAGGIMEYLKKMQTVN
FT                   RN"
     atgataatag aaggtccagt aattaagttt ggtgataaaa tagatactga tataataatt        60
     ccagctaggt acttaaaata tactgaccca cagtatttag cacagcacgc tatggaacca       120
     ttagacccag agttttacaa gaaggcatca aagggtgtta taatagttgc gggtaaagta       180
     tttggaatgg gatcctcaag agaacaagct gccatagccc taaaggctgc tggagttaag       240
     gcagtagttg ctgagtcatt cgctagaata ttctatagga atgcgataaa taatggttta       300
     ccagtcataa cgttgcctaa ttccacgaag gagatagatg aaaacagtta cgtcaaaatt       360
     gacgtggaga ctggtgaaat cttggttggt aataaggtgc ttaagggaaa gggcataaca       420
     gggatggcac tagagattct acaagctgga ggaataatgg aatatctaaa gaagatgcag       480
     acagttaacc gaaactaa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page