(data stored in ACNUC7421 zone)

EMBL: CP001402.PE279

CP001402.PE279       Location/Qualifiers
FT   CDS_pept        complement(242352..242639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40915"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKV0"
FT                   /protein_id="ACR40915.1"
FT                   /translation="MAKKRSKLEIIQAILEACKSGSPKTRIMYGANLSYALTGRYIKML
FT                   MDLEIIKQEGKQYMLTKKGEELLEDIRRFNDMRKNMDQLKEKINSVLSIK"
     atggctaaga aaagaagcaa gctagaaatt atacaagcaa tacttgaggc atgtaaatct        60
     ggatctccca agaccagaat aatgtatggt gccaatctaa gctatgctct aactgggaga       120
     tatataaaga tgttaatgga tttagaaatc ataaaacaag aaggaaaaca gtacatgtta       180
     actaagaagg gagaggaact acttgaagat ataaggagat ttaatgatat gagaaagaat       240
     atggatcaat taaaggagaa aattaatagc gttctatcca ttaaataa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page