(data stored in ACNUC7421 zone)

EMBL: CP001402.PE28

CP001402.PE28        Location/Qualifiers
FT   CDS_pept        25264..26316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0028"
FT                   /product="Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40664"
FT                   /db_xref="GOA:C4KJE4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023819"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJE4"
FT                   /protein_id="ACR40664.1"
FT                   /translation="MLWLVMTTGKCNLKCDYCGGSFPANVVPYGVKYDINLLKRLVEND
FT                   KESTIIFYGGEPLLNYKFIMTVLDNVRAKRYGIQTNGIAVRLLPEKYWRKINVALLSID
FT                   GREETTDKHRGKGIYKAVLRSAKYLKDLGVETIARMAVTQDSDIFADVMHLIDLGLFDK
FT                   VHWQLDVIWSEEWDFKSWSFSYLHGIKRLTEYFLSELRKGRVVKIIPILGVISAHFFDG
FT                   YKGSPCGAGYSSVTVTPDGRILSCPIAVREKWAELGNVNLGYRLLEDPLPDDCKRCEFK
FT                   RYCGGRCLYAQKERYWGEEGFKVVDEVNKEYLRTVLSIIPEIEKLIRDGNIRLSDLYYN
FT                   PLLDSTEIIP"
     atgctatggc tagtaatgac tacgggaaaa tgtaacctta aatgtgatta ttgtggaggt        60
     tcttttccag ctaatgttgt accttatggt gttaaatatg atatcaattt acttaaaaga       120
     ctggtagaga atgacaagga gtccacaata atattctacg gtggagagcc attgcttaat       180
     tacaaattta taatgaccgt tttagataac gtaagagcta agagatatgg catacaaact       240
     aatggtattg cagtaagact tcttcctgaa aaatattgga gaaaaattaa tgttgcgttg       300
     ttatctatag atggtagaga ggaaactact gacaaacata gaggtaaggg tatttataaa       360
     gcggttttgc gatcagcgaa ataccttaag gatctaggtg ttgaaactat agctagaatg       420
     gcagttacac aagatagtga catctttgct gatgtcatgc atttaataga tttaggttta       480
     tttgataagg tacattggca attagatgta atatggagtg aggaatggga ttttaaaagt       540
     tggtcttttt cgtacttgca tgggataaaa cggctgactg agtatttcct ttcagaacta       600
     aggaagggaa gggttgttaa aataataccc atattaggtg taattagtgc tcatttcttt       660
     gatgggtata agggttctcc gtgtggtgca ggatattcat cagtcactgt cactccagat       720
     gggagaatac tttcttgccc aatagcggta agggaaaaat gggctgaatt gggtaacgta       780
     aatttagggt atagactctt agaggatcca ttaccagatg attgcaagag atgcgagttt       840
     aaacgatatt gtggtgggag atgcttatat gcgcaaaagg agagatactg gggtgaggag       900
     ggatttaaag ttgttgacga agttaacaag gaatatcttc gtacggtact ctcaataata       960
     ccagaaattg aaaagcttat cagagatggt aatataagac ttagcgattt gtattataat      1020
     ccgttacttg attcaactga gatcattcct taa                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page