(data stored in ACNUC7421 zone)

EMBL: CP001402.PE280

CP001402.PE280       Location/Qualifiers
FT   CDS_pept        242787..243521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40916"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKV1"
FT                   /protein_id="ACR40916.1"
FT                   /translation="MERIDIASVKGGVGKSFIAYFLSKALAASHKILLIDKDLTSTLSR
FT                   VYYIKGNLLSYLTVGQSSLAYFKEVDSGLTVVNVGCSRKIKNVEPKKIADIYSGFSDYD
FT                   LMIVDNPPIPSDVCLDTELQAYYTYLNEKRLDYNLILILPPNQLLLDESLAFMQLFKDY
FT                   IKNELSISLGSDLVNFDVISSVINMYNPRERIDVNKIKDLTSKIVKIPFKKEAIYTPFN
FT                   QLNMPMEISELAKYVLEYLESK"
     atggaaagaa ttgacatagc aagcgttaaa ggtggtgtag ggaaatcatt tatagcttat        60
     tttctgagta aagcacttgc tgcaagtcac aaaatattac tgatagataa agatttaaca       120
     tctacactta gtagggtcta ctatataaaa ggcaacttat tatcttattt gacagtgggt       180
     caatcctctt tagcttattt caaagaagtt gacagtggac ttacagtagt taatgtaggc       240
     tgcagtagaa agataaaaaa tgtagaacct aaaaaaattg cagatatcta tagtggcttt       300
     tcagattacg atttgatgat agttgataac ccaccaatac cctcagatgt ttgtttagat       360
     actgagcttc aagcttatta tacttatttg aatgaaaaga gattagatta caatttgatc       420
     ttaatattac ccccaaatca gcttttgtta gatgaaagtc tggcattcat gcaactattt       480
     aaggattata ttaagaatga attaagtata tctctgggaa gtgatttagt aaattttgat       540
     gtaatatcct cagtaataaa catgtataat cctagggaaa gaatagatgt taataagatt       600
     aaagatttaa ctagtaaaat agttaaaatt ccattcaaga aagaggcaat ctatacaccc       660
     tttaatcagc taaacatgcc gatggaaatt agtgaattgg caaaatatgt gctagagtat       720
     ctagaaagta agtga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page