(data stored in ACNUC7421 zone)

EMBL: CP001402.PE281

CP001402.PE281       Location/Qualifiers
FT   CDS_pept        243648..243842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0283"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40917"
FT                   /db_xref="GOA:C4KKV2"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKV2"
FT                   /protein_id="ACR40917.1"
FT                   /translation="MVSVKSILAGILLLIPFIVYFAIPTYNKVEPDLGSLPFFYWYQTV
FT                   WLAISTILFSIAALLLARR"
     atggtaagtg tgaaaagtat tttagcggga attctacttc taataccatt tatcgtatat        60
     tttgcaatac caacatataa taaagtagag ccagacttag ggagtttgcc gttcttctat       120
     tggtatcaaa cagtgtggtt ggcaatatca acaatacttt tctcaatagc tgcgctcctt       180
     cttgccagaa ggtga                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page