(data stored in ACNUC7421 zone)

EMBL: CP001402.PE283

CP001402.PE283       Location/Qualifiers
FT   CDS_pept        245429..246172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0285"
FT                   /product="Silent information regulator protein Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40919"
FT                   /db_xref="GOA:C4KKV4"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR028628"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKV4"
FT                   /protein_id="ACR40919.1"
FT                   /translation="MIYEKVAEELISSSYAIAFTGAGISTASGIPDFRGPQGLWKKYSP
FT                   ELASIEYFEKDPKNFWGFYSLRMRGLFEAQPNKAHYSLAELEKMGIIKVIITQNIDGLH
FT                   QKAGSKNVIELHGTMRRSYCVLCLRTYDSLNVLSMIEKGNLPPRCDCGGIIRPDVVLFG
FT                   EPVKNIYEALSIAYESDLVISIGSSLTVYPANLIPQTVKERGGKLIILNMEETPLDSIA
FT                   DYVVREPVEISLPKIVENVRQKILS"
     atgatatacg agaaagtagc tgaagaactt atttcctctt cttacgccat agcctttacc        60
     ggagccggta tcagtacagc ttctggtatt cccgatttca gaggtcctca aggattatgg       120
     aagaagtatt caccagagtt agctagtata gaatattttg aaaaagatcc taaaaatttt       180
     tggggattct actcattaag aatgagggga ttattcgaag cccaacctaa taaggcacac       240
     tactctttgg ctgagttaga aaagatgggc ataataaagg taataataac acaaaatatt       300
     gacggtctac atcagaaggc tggttctaag aacgttattg agcttcacgg aactatgagg       360
     aggtcatatt gcgttttatg cttaaggact tatgattcgc taaacgtcct aagtatgata       420
     gaaaagggta atcttccacc taggtgtgat tgtggtggga taataaggcc agatgttgtg       480
     ctttttgggg aaccagttaa gaacatttat gaggcactaa gtattgccta tgaatctgat       540
     ctcgtaatct caattggttc ttcattaact gtatatccag ccaatttaat tccacagacc       600
     gtaaaagaaa gaggtggtaa gctaataatt ttaaatatgg aggagacccc gttggatagt       660
     attgcggatt acgttgtaag ggaaccagtg gaaatttcat tgcccaagat agttgagaac       720
     gtgagacaga aaatactttc gtga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page