(data stored in ACNUC7421 zone)

EMBL: CP001402.PE287

CP001402.PE287       Location/Qualifiers
FT   CDS_pept        complement(247637..248092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0289"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40923"
FT                   /db_xref="GOA:C4KKV8"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KKV8"
FT                   /protein_id="ACR40923.1"
FT                   /translation="MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEF
FT                   FHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAV
FT                   GMALSKNPILLIIPCHRVIAENGIGGYSRGVKLKRALLELEGVKIPE"
     gtgctagtgt atgggttgta taaaagtcct cttggctata taactgttgc taaggacgat        60
     aagggattta ttatgttgga tttctgtgac tgtgtggaag gaaattcaag agacgatagt       120
     agttttactg aattcttcca taagctagat ctctactttg agggtaagcc aataaactta       180
     agggagccta ttaacctaaa gacctatcct tttagattat cagtatttaa agaagtaatg       240
     aagattccct ggggaaaagt tatgacgtat aaacagatag cagattcact gggaacttct       300
     ccaagagctg ttggtatggc tttatctaaa aatcccattc ttttaatcat accatgccac       360
     cgagtaatag ctgaaaatgg tattggagga tactccagag gagtaaagtt gaagagagcc       420
     ttattggaac tagagggagt caaaatacca gaatga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page