(data stored in ACNUC7421 zone)

EMBL: CP001402.PE289

CP001402.PE289       Location/Qualifiers
FT   CDS_pept        249819..250775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0291"
FT                   /product="Oligosaccharide biosynthesis protein Alg14 like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40925"
FT                   /db_xref="GOA:C4KKW0"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKW0"
FT                   /protein_id="ACR40925.1"
FT                   /translation="MTRILIIASGGGHTGFARAIAQYLPEKVDFVIPTNDPYSRQMISQ
FT                   YANKIYEIPKGREPDESSLVLFKRLFSIIAKSANIKKYDLIIATGSNHSIFPSFFQFLK
FT                   GGKVYGIESQDRLITKGKAIGIISNYAKGVFLHWQEQRKLYEKKGIVVGPIVEKPKYES
FT                   KDEGYILVTTGSMGFKRLFDAIVKSVIGKRIVIQTGKIDPTIYRNQNVTTFSFDPDLEK
FT                   WIANASLVITHQGKTAMEAVVMYRKPVIMVYNNDWKSATTLSDAKKYAEILGATFLSDP
FT                   ITWSDYNVLLEAIENANEPNVFDTGTPNLVKHVLSEL"
     gtgacaagaa tcttaataat agccagtggt ggtggtcata caggcttcgc cagggctatt        60
     gcccaatatt tacccgaaaa agtagatttc gtgataccaa caaatgatcc ttacagtaga       120
     caaatgatat cgcaatatgc aaataaaatc tacgagatac ctaaaggaag agaaccagac       180
     gaaagtagtc tagtattatt taagagatta ttctctataa tagcaaagag cgccaatatt       240
     aagaaatacg atttaatcat agccaccggg agcaatcact ccatatttcc ttcctttttt       300
     caattcttaa aaggtgggaa ggtttacggt atcgaaagtc aagatagact tatcaccaag       360
     ggaaaggcga taggcataat atcaaattac gcaaagggtg tatttcttca ttggcaagag       420
     caaaggaaac tttatgaaaa gaagggtatt gtcgtgggac ccattgttga aaagcctaag       480
     tatgagagta aggatgaagg ctacatatta gttacaactg gtagcatggg ttttaagagg       540
     ttatttgacg caatagtgaa atccgttata gggaagagga ttgtcataca gacggggaaa       600
     atagatccca caatctatcg taatcaaaat gttactacgt ttagttttga tccagattta       660
     gaaaagtgga ttgctaatgc atctttggta ataacgcatc aaggtaaaac tgccatggag       720
     gcagtagtaa tgtataggaa gccggtaata atggtttaca acaacgattg gaagagtgca       780
     actacgttaa gcgatgccaa gaagtatgct gagatattgg gagctacgtt tttaagtgat       840
     ccaataacgt ggagcgatta taacgtttta ttagaagcta tagaaaacgc taatgagcct       900
     aacgtttttg atacaggtac tccaaatctg gttaaacatg tattaagtga actataa          957
//

If you have problems or comments...

PBIL Back to PBIL home page