(data stored in ACNUC7421 zone)

EMBL: CP001402.PE29

CP001402.PE29        Location/Qualifiers
FT   CDS_pept        26342..27037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40665"
FT                   /db_xref="GOA:C4KJE5"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJE5"
FT                   /protein_id="ACR40665.1"
FT                   /translation="MSVKFEESSRLLETIKSMLASATSSILIVTYSIDQEAASEILTRA
FT                   ASGVNTVLVTADKDWARWLKNQSEAYKKDEEKRLYRELRRNESIYVQIIYFTSIISIAI
FT                   AIIDIILYFMMGSLIYYDVPLSLIAIGFLIYYGIRKRREALSQISILRESVQNFVQEVS
FT                   QIRDKIKEKLKIIEIDSQVSFSIVSCDDKTILFSAPLKFSMDKPSVHVVMEISKQLADQ
FT                   LVNLILKIS"
     atgagtgtta aattcgagga aagtagtaga ttgttagaga ctataaagag tatgctagcc        60
     tctgctactt cttctatttt aatagttaca tatagtattg atcaagaagc cgcttccgaa       120
     atactgacta gagcagcgag cggagttaat acagtcctag taacagctga taaggattgg       180
     gcacgatggt tgaaaaatca gtctgaggct tataaaaaag atgaagagaa gagattatat       240
     agggagctga gaagaaatga aagtatttac gtgcaaataa tttatttcac ttcaatcatt       300
     tctatagcca ttgctataat agatattatc ctttatttca tgatgggtag cctcatctat       360
     tatgatgttc ctttatcttt aattgctata gggtttttga tttactatgg aataagaaag       420
     aggagggaag ctttatctca aataagtata ttgagggaga gtgttcagaa cttcgtacaa       480
     gaggtcagtc aaatcagaga taagatcaaa gaaaagttga aaattataga aatcgatagt       540
     caagtttcct tttcaattgt ttcttgtgat gataaaacta ttttattttc tgcacctctt       600
     aagttttcaa tggataaacc ttctgttcat gtagttatgg aaatctctaa acaactcgcc       660
     gatcagctag ttaatcttat actaaaaata agctag                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page