(data stored in ACNUC7421 zone)

EMBL: CP001402.PE294

CP001402.PE294       Location/Qualifiers
FT   CDS_pept        254670..255032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40930"
FT                   /db_xref="GOA:C4KKW5"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKW5"
FT                   /protein_id="ACR40930.1"
FT                   /translation="MKKKAIGLSDDGYYVIFFISESEIGYKKTQINEMYYVSFIIVLLV
FT                   SILYVIFRYILVLTLFIIPILVYLFTIAISLHLYKPEIYEKITRVEIKDKIIKIHTSNK
FT                   TFIIHRGKILGFTDQI"
     gtgaaaaaga aagcaattgg gctaagtgat gacggttact atgtaatatt tttcatatcg        60
     gagagtgaga tagggtataa aaagactcaa attaacgaga tgtattatgt ctcattcatt       120
     attgtcttat tggtttccat tttatatgtg atttttagat atattttagt cctaacactt       180
     tttataatac ccattttagt ctatctattc actattgcga tctcattaca tctctataaa       240
     cctgaaattt atgaaaaaat aactagggtt gagataaagg ataaaatcat taagattcac       300
     acttctaaca aaacgtttat aatacatagg ggaaaaatcc ttggtttcac tgaccagatt       360
     tag                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page