(data stored in ACNUC7421 zone)

EMBL: CP001402.PE295

CP001402.PE295       Location/Qualifiers
FT   CDS_pept        complement(255016..255216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0297"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40931"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKW6"
FT                   /protein_id="ACR40931.1"
FT                   /translation="MKEREVEAKRLVGKKNVRGKIYEYEYFTLPLNLYLPKSMVEKFGT
FT                   KYMLQVDEDSGTITIKPKSGQ"
     atgaaagaaa gagaagtaga agctaaaaga ttagttggaa agaagaatgt gagaggaaaa        60
     atatacgagt atgaatactt cacgttaccg ttgaacctat acttgcctaa gtcaatggta       120
     gagaaattcg gaacaaaata tatgcttcaa gttgatgagg atagtggaac aataacaata       180
     aagcctaaat ctggtcagtg a                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page