(data stored in ACNUC7421 zone)

EMBL: CP001402.PE297

CP001402.PE297       Location/Qualifiers
FT   CDS_pept        256563..257327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0299"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40933"
FT                   /db_xref="GOA:C4KKW8"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKW8"
FT                   /protein_id="ACR40933.1"
FT                   /translation="MIRRLTISPLFLILSLIAYYLSRNDILLYSTLSTILFWTFIILIL
FT                   PTSFYNYIKDGIVKYCKKKIFWFTVGLYISYHVILYSFFFYLLLPGSIKNISFRFSFNA
FT                   GIGYSIPPPITYFLEWVSNSPAIWFFIGPYEGDVIPFSTFLGVVLALLIGLNVMKILEL
FT                   WGISNKLSKSIVLIPSLGVVSGSSCCVFLPSIVMYSIALSISSITVTILSILSSFAYFI
FT                   LAYYALPIVSAIVLFHNLTMLNRLIKKLSFTM"
     atgattagaa ggctaacaat atccccttta tttttgatac tctccttgat agcttattat        60
     cttagtagaa atgacatact tctctactca acattatcca caatattgtt ttggacattc       120
     ataatcttaa tcttaccgac ttctttctat aattatatca aggatggtat tgtaaaatat       180
     tgcaaaaaga aaatattttg gttcacagta ggattatata tatcatatca cgtgattctc       240
     tattcgttct tcttctattt attgcttcct ggctctataa agaacataag ttttaggttc       300
     tcgtttaatg cgggaatagg atattccata ccgcccccaa tcacttactt tcttgaatgg       360
     gtatcaaata gtcctgcaat atggtttttc ataggtcctt atgaggggga tgttatacct       420
     ttctctactt tcttaggagt agttctagca ttattaatag gcttaaatgt tatgaaaata       480
     ttggaattat ggggaatttc aaataaactt agcaaatcaa tagttttgat cccctctttg       540
     ggagtcgtat ctggctcatc ttgttgtgta ttcctaccaa gtatagtaat gtactctatt       600
     gctctctcaa taagctcaat tactgtgaca atactttcca ttttgtcctc attcgcgtat       660
     ttcatattag cctattacgc cctaccaata gtttcagcta ttgttctatt tcacaatctt       720
     accatgctta atagactaat caagaaacta tcatttacca tgtag                       765
//

If you have problems or comments...

PBIL Back to PBIL home page