(data stored in ACNUC7421 zone)

EMBL: CP001402.PE299

CP001402.PE299       Location/Qualifiers
FT   CDS_pept        258356..258799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40935"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX0"
FT                   /protein_id="ACR40935.1"
FT                   /translation="MIEWKGFGKRWGKCEECWLAYERRIQHENSLNCYKLGIPIDALKI
FT                   PLDQFLNIVKDVPGKYAIFGFPLNLLSKGVIIFYFDTKEEMENFIENIMNYIKSEISFR
FT                   EKKFYDIFVNTEWIGSMNWRRGCPEYDKKFGDWRGWRNHSKET"
     atgatagagt ggaagggctt tggaaaaaga tggggtaagt gtgaagagtg ttggttggct        60
     tatgaaaggc gaattcaaca tgaaaattct ttgaactgtt ataaactggg aattccaata       120
     gatgccctaa aaattccctt ggatcaattt ttaaatatag ttaaggatgt ccctggaaaa       180
     tatgcgattt ttggatttcc cctaaaccta ttaagtaagg gagtcataat tttttatttt       240
     gatactaaag aagagatgga aaactttata gaaaatataa tgaattatat taagagtgaa       300
     atatccttta gggaaaagaa gttttatgat atttttgtta atacagagtg gattggaagt       360
     atgaattgga gaagagggtg tccagaatac gataagaagt ttggcgattg gagaggatgg       420
     aggaatcaca gtaaagaaac ttag                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page