(data stored in ACNUC7421 zone)

EMBL: CP001402.PE3

CP001402.PE3         Location/Qualifiers
FT   CDS_pept        2010..2330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0003"
FT                   /product="conserved hypothetical M protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40639"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJB9"
FT                   /protein_id="ACR40639.1"
FT                   /translation="MMWEKIKRLEERLYELRKEIEEVEKELEELPSGHLEVKTINGNVY
FT                   YYLRYWEDGRLRSKYIGKFASDIKEKLLKSEQLRRRLTQLKEEEKKLSNIIDKIEKIIT
FT                   DY"
     atgatgtggg agaaaattaa gaggctagaa gaaagattgt atgaactaag aaaggaaatt        60
     gaggaagttg aaaaagaatt agaagaatta ccaagcggac atcttgaggt aaagacgatt       120
     aacggaaatg tctactatta cttaaggtat tgggaggatg gtagactaag aagcaaatat       180
     attggcaagt tcgctagtga tattaaggaa aaacttttaa agagcgagca attaagaaga       240
     agattaacac aattaaaaga ggaagaaaag aagttatcca atattattga caaaatagaa       300
     aagattatta ctgattatta a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page