(data stored in ACNUC7421 zone)

EMBL: CP001402.PE300

CP001402.PE300       Location/Qualifiers
FT   CDS_pept        258825..259556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40936"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX1"
FT                   /protein_id="ACR40936.1"
FT                   /translation="MNTSIDILLHYIFYIRMKAVRIFLTNLYQGKCLPKIDMSISIFVL
FT                   SLKGGIGKSRLSYELSRYISKRKFKKVLLIDNDSLSTLSNLLGHYGDGLLDGFDLRSSL
FT                   KEIDDIFILKLRNKVYFLDNFYDNERLKQLKFVLSRNWDYIIVDNYVGITETNPIIKIV
FT                   YEFSQLKIGIFLSDDLSLNSTTEYSNSWNYLDSKYVLLTNKPFDVHNIINRTIINAILN
FT                   QGEENYDEKFNIEKTNKINAS"
     gtgaatactt ctatagatat tcttcttcat tatatatttt atattaggat gaaagcagtt        60
     agaatctttc taactaatct ttatcaaggg aaatgcttac ctaaaataga tatgtctatt       120
     tcaatttttg tcctaagcct aaaaggtgga atagggaaga gtaggctatc ttatgagtta       180
     tccagatata tctctaaaag gaaatttaag aaggtactgc ttatcgataa tgattctcta       240
     tctactttat cgaatttact aggtcattat ggtgatggat tactagatgg tttcgattta       300
     aggtcttcat taaaagaaat agacgatatt ttcatactta aattacgtaa taaagtatat       360
     tttttagata atttttatga caatgaaaga ttgaagcaac ttaaattcgt tttatccaga       420
     aattgggatt atattatagt agataattat gttggaataa cagagacaaa tccaataatt       480
     aaaatcgtct atgagttttc tcagctcaaa ataggtattt ttcttagtga tgacttatcg       540
     ctaaattcta caactgaata ttccaatagt tggaactatc tagattctaa atatgtatta       600
     ttaacaaata agccttttga tgttcataat attataaaca gaactattat taatgctata       660
     ttaaaccagg gcgaagaaaa ctatgatgaa aaatttaaca tagagaaaac taacaagata       720
     aatgcatctt ag                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page