(data stored in ACNUC7421 zone)

EMBL: CP001402.PE301

CP001402.PE301       Location/Qualifiers
FT   CDS_pept        259671..260588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0303"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40937"
FT                   /db_xref="GOA:C4KKX2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX2"
FT                   /protein_id="ACR40937.1"
FT                   /translation="MPLDPRIKELLESGFVVPIGKASVDEVRKIFRQLASAAPKVEVGK
FT                   VEDIKIPGSEASINARVYLPKANGPYGVLIYLHGGGFVIGDVESYDPLCRAITNACNCV
FT                   VVSVDYRLAPEYKFPSAVIDSFDATNWVYNNLDKFDGKMGVAIAGDSAGGNLAAVVALL
FT                   SKGKLNLKYQILIYPAVGFDNVSRSMIEYSDGFFLTREHIEWFGSQYLRSPADLLDFRF
FT                   SPILVQDLSGLPPALIITAEYDPLRDQGEAYANRLLQAGVPVTSVRFNNVIHGFLSFFP
FT                   LIEQGRDAIGLIGSVLRRAFYDKS"
     atgcccctag accctcgaat caaagagctc ctagaatcag gttttgtcgt accaattggt        60
     aaagcctcgg tagatgaggt aagaaaaata tttaggcaat tagcatcagc cgcgcctaaa       120
     gttgaagttg gaaaagtaga agatataaaa ataccaggta gtgaagccag tataaacgct       180
     cgagtatatt tgccaaaggc taacggtccc tatggagttt taatatatct tcatggagga       240
     ggctttgtta taggagatgt ggaatcttat gacccattgt gtagagctat caccaatgca       300
     tgcaactgtg tcgtagtatc agttgattat aggttagctc cagaatataa gtttccttct       360
     gctgtcatcg attcatttga tgctactaat tgggtttata ataatttgga caagtttgat       420
     ggaaaaatgg gcgtcgctat tgcaggggac agcgctgggg gaaatttggc agcagttgta       480
     gctcttcttt caaagggtaa acttaattta aagtatcaaa ttctaattta ccctgctgta       540
     ggtttcgata acgtttcaag atccatgata gaatactctg atggtttttt cctaactaga       600
     gaacatatag agtggttcgg ttctcaatac ttgcgaagtc ctgcagactt gctagacttt       660
     aggttttctc caattctagt acaagattta agcggattac ctccagcctt aataataaca       720
     gcagaatatg acccattaag ggatcaagga gaagcttatg cgaatagatt actacaagct       780
     ggagtaccgg ttaccagtgt taggttcaat aacgttatac acggattcct ttcatttttc       840
     ccgttaatag agcaaggaag agatgctata ggtttaatag gctctgtttt aagacgcgca       900
     ttttatgata aaagttaa                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page