(data stored in ACNUC7421 zone)

EMBL: CP001402.PE302

CP001402.PE302       Location/Qualifiers
FT   CDS_pept        260665..261675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0304"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40938"
FT                   /db_xref="GOA:C4KKX3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX3"
FT                   /protein_id="ACR40938.1"
FT                   /translation="MKAVILPAHKQGYRIEEVPDPKPGKDEAIIKVNKAALCYRDLLQI
FT                   KGFYPRSKYPLILGHEVVGTVEEVGEDVNNFKKGDRVTSMLFVPDWSCEYCKSGEEVYC
FT                   KNRVVYAQELDGFFAEKAKVKASSLVKVPESVSDEGAVIVPCVAAMVYRGLKKAGIKKG
FT                   EIVLVTGASGGVGIHAIQVAKALGAKVIGVTSGESKAKIVSKYADYVIVGEKFSEEAKK
FT                   IGDVSIVIENVGPYTLEESMKSLRSGGKIIQIGNLDPSVTFNLRLGYIILKDISLMGHI
FT                   GANKNDIIKTLNLVKEGKIKPVIGSEVSLENFGKALDLLNDSKNRYGKILISNSF"
     atgaaagctg ttattcttcc agctcataaa caaggttata gaattgagga agtaccagat        60
     cctaaaccgg gtaaggatga agccattatt aaggttaaca aggctgcact gtgttatagg       120
     gacttattgc aaataaaagg attctacccc agatctaaat acccgttaat tttaggtcat       180
     gaagttgtgg gaactgtaga ggaagttgga gaagacgtta ataattttaa gaaaggagat       240
     agagttacgt caatgctttt tgtccctgac tggtcatgtg aatattgtaa aagtggagaa       300
     gaagtttact gtaagaatag ggttgtatac gctcaagaat tagatggatt tttcgcagaa       360
     aaagctaaag ttaaggcaag cagtctagtt aaagtacctg agagtgtttc cgatgaggga       420
     gctgttatag taccatgtgt tgctgcaatg gtttataggg gtttgaaaaa agctggaata       480
     aaaaaaggag aaattgtatt ggttactgga gcaagtggtg gtgtaggtat tcatgctatt       540
     caagtagcta aggctttagg ggctaaggta ataggagtta ctagtgggga aagcaaggct       600
     aagatagttt ctaaatatgc tgactacgta attgtaggtg agaagttctc agaagaggct       660
     aaaaagatag gtgacgtttc cattgtaatt gaaaatgtgg gtccctatac gctagaagaa       720
     agtatgaaga gtctgaggag tggcggtaag attatacaga tcggtaattt agatccttct       780
     gtaacattta atttaaggct gggctatatt attcttaaag acataagttt aatggggcat       840
     ataggcgcaa ataaaaatga tataataaaa actctaaacc ttgttaagga gggtaaaata       900
     aaacctgtta ttggaagtga ggttagctta gagaattttg gaaaagctct tgacttgctt       960
     aatgacagta aaaataggta cggaaaaata ttgatctcaa actctttcta g               1011
//

If you have problems or comments...

PBIL Back to PBIL home page