(data stored in ACNUC7421 zone)

EMBL: CP001402.PE307

CP001402.PE307       Location/Qualifiers
FT   CDS_pept        complement(265598..266644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0309"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40943"
FT                   /db_xref="GOA:C4KKX8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX8"
FT                   /protein_id="ACR40943.1"
FT                   /translation="MKAAVYKGYGLPLEIEEVPNPAPKEGEVLVKVASTGICHSDLHLL
FT                   SGELVGPLPNGFIIGHEIAGWVEKIGENVKNPYGLKEGDPVLVSWIVPCGICRYCANGK
FT                   ENYCKDNAKRLVGLIGINGGHAEYLTVPEIAVIPLAKNLDPYYSSPIACAYGTAYNALK
FT                   SANATSGKSVVIVGAGGVGSAAIQLANSIGLNPIVAVDIDENKLKSAKLLGATHIINAN
FT                   ENDARAKVLEALEDGADIVYETKPYPDFKLSLEVVKSGGTIVVTGLGGFSTLAQIPVTL
FT                   FVSRGITLVGSLGYRPRIDLPDLVSLASSGKIDIKKLVSHIYTPDRINEAYENLKKGLH
FT                   IRAIIRWN"
     atgaaagcag ccgtatataa agggtatgga ttaccattag aaatagaaga agttcccaat        60
     ccagctccaa aagaaggaga agtcttagtg aaagtagcat cgaccggaat atgccatagc       120
     gatttacatc tattaagtgg tgaattggta gggccacttc ctaacgggtt tataattggt       180
     cacgaaatag ctgggtgggt agagaagata ggtgagaacg ttaagaatcc atatggacta       240
     aaggagggag atccagttct agtatcttgg atagttccat gtggtatatg tagatattgc       300
     gcaaatggaa aggagaatta ttgtaaagat aatgcaaaga gactagtagg tctaattggt       360
     attaatggag gtcatgctga gtatttaact gttccagaga tagcagtaat tcctctggcc       420
     aaaaatcttg atccatacta ttcttctcca attgcatgtg catatggtac tgcttataat       480
     gcattaaaga gtgcgaacgc tacttcagga aagagtgttg ttatagtggg agctggtggt       540
     gtaggttctg ctgcaataca attggctaac tcaattggat taaatcctat tgttgcagtc       600
     gacatagatg agaataagtt aaagagtgct aaattactgg gcgcaactca tattattaac       660
     gctaacgaaa atgatgcgag ggcgaaagtt ctggaagctt tagaagatgg tgctgatata       720
     gtatatgaga caaaacctta tccagatttc aaattatcgt tagaagtagt taaaagcggt       780
     gggactatag ttgttacggg attgggagga ttctctacat tagcacaaat tcccgtaaca       840
     ctattcgtct ccagaggtat aaccttagta ggaagtttag gctacagacc tagaattgat       900
     ttacccgatc tagtaagttt ggcctcttcc gggaaaatcg acattaagaa gttagtttcg       960
     catatttaca ctccagacag gataaatgag gcttatgaga atttaaagaa agggttacac      1020
     ataagggcta taataagatg gaattag                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page