(data stored in ACNUC7421 zone)

EMBL: CP001402.PE308

CP001402.PE308       Location/Qualifiers
FT   CDS_pept        complement(266927..267331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40944"
FT                   /db_xref="InterPro:IPR021578"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX9"
FT                   /protein_id="ACR40944.1"
FT                   /translation="MEITFPTQHDIQALAKILSDPIFTLYKILGAETVSVKGNEFDALI
FT                   SLGVTSLILHGTVYVGNNKVSYKFYSVGTQKGEGGVLEFDLFKEGEIRLIVEFEGRFAS
FT                   FIKFSLRRKIEKNIKRLDEEVRLERIKRKI"
     atggaaatca cgttccctac acagcatgat atacaagctt tagcaaaaat tctgtcagat        60
     cctattttta cgttatacaa gatattagga gctgaaacag tatctgtaaa gggtaatgaa       120
     tttgatgcct tgatatcgtt aggagttaca tcattaattc tacacggtac ggtctatgta       180
     gggaataata aggtgtctta taagttttat agtgtgggaa cacaaaaggg agaaggtgga       240
     gttttagaat ttgacttatt taaagagggt gagattagac taatagtaga atttgaaggt       300
     agatttgctt cttttattaa attctcacta agaagaaaaa ttgagaaaaa tatcaaaaga       360
     cttgacgagg aagtaaggtt agaaagaatt aagagaaaga tctga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page