(data stored in ACNUC7421 zone)

EMBL: CP001402.PE31

CP001402.PE31        Location/Qualifiers
FT   CDS_pept        28274..28603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40667"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJE7"
FT                   /protein_id="ACR40667.1"
FT                   /translation="MIERGTLVSLEEFKSNQKLKENVKNGIKGLVKLLFQEAGKIIKFT
FT                   SNDDLIFQLMKLGLISATLAQELLDILKIVNNLDSVDDEILHSMLVRIMEVIEEAINSI
FT                   DKYMG"
     atgattgaaa ggggaacatt agtaagtctc gaggaattca aaagtaatca gaaattaaag        60
     gaaaatgtta agaatgggat aaaaggttta gttaagttac tttttcaaga agctggtaag       120
     ataattaaat ttacctctaa tgacgatttg atatttcaat tgatgaagtt aggattaatt       180
     tcagctactt tggctcaaga acttcttgac attcttaaaa ttgtaaataa tctagatagt       240
     gttgatgacg aaatattaca cagtatgctt gtaagaatta tggaagttat tgaagaggca       300
     ataaatagta tagataaata tatgggctaa                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page