(data stored in ACNUC7421 zone)

EMBL: CP001402.PE313

CP001402.PE313       Location/Qualifiers
FT   CDS_pept        complement(271910..272353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40949"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKY4"
FT                   /protein_id="ACR40949.1"
FT                   /translation="MAEFVYPSKEWAEEWCKLLNESKEYNDAGKGWVSPILFVATDIPI
FT                   QVLDYLGVKGTNAIAMKLYLNNGKCQGTEFFSDITKADAPYVLEASYNSWKDIISGKLQ
FT                   VVSALLSGTIKLKKGSLFDLARYTTASVVMANISNKINTKFLV"
     atggctgagt ttgtgtatcc tagtaaggaa tgggcagaag aatggtgtaa actactaaat        60
     gaaagcaagg aatataatga cgcagggaaa gggtgggttt cgccaatttt attcgtggca       120
     accgatatcc ctatccaggt attggactat ttaggtgtaa agggtactaa cgctatagca       180
     atgaagcttt atctaaataa tggaaagtgt caaggtacgg agtttttcag cgatattacc       240
     aaggctgatg ccccatacgt acttgaggca agttataatt cttggaagga tataattagc       300
     ggaaaactac aagttgtctc agccttgttg tctggcacaa taaagcttaa gaagggtagc       360
     ctcttcgatc tggctagata cactactgct tcagtggtta tggctaacat ctcaaataaa       420
     ataaatacaa aattccttgt ttag                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page