(data stored in ACNUC7421 zone)

EMBL: CP001402.PE315

CP001402.PE315       Location/Qualifiers
FT   CDS_pept        273583..273939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0316"
FT                   /product="protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40951"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKY6"
FT                   /protein_id="ACR40951.1"
FT                   /translation="MRDDEIRESYFKYFNEEKLPFIQCKNCGHRFYYPRAFCPKCGSSD
FT                   VEVRFSEGRGKIFAMTKVYRKDGSYVIYGIVELEEGFRMYSNIVEGNQADIAKRVEVIF
FT                   KEINGKKYPLFKVI"
     atgagagatg acgagataag agaatcatac tttaaatatt tcaatgagga gaagttaccg        60
     tttattcaat gtaaaaattg tggtcatagg ttttactatc caagagcatt ttgtcctaaa       120
     tgtggctctt cagatgttga agttagattt agtgaagggc gaggtaaaat atttgcgatg       180
     accaaagttt ataggaagga tggtagctac gttatttatg ggatagtaga gttagaggag       240
     ggatttagaa tgtattccaa tatagtcgag gggaatcaag ctgacattgc taagagagtt       300
     gaagtaatat ttaaggagat taacggcaag aaataccccc tatttaaggt tatctag          357
//

If you have problems or comments...

PBIL Back to PBIL home page