(data stored in ACNUC7421 zone)

EMBL: CP001402.PE317

CP001402.PE317       Location/Qualifiers
FT   CDS_pept        275701..276813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0318"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40953"
FT                   /db_xref="GOA:C4KKY8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKY8"
FT                   /protein_id="ACR40953.1"
FT                   /translation="MSKNEDELEEYRSKIREWIRNNVPEEISSKGDMAPPEILREWQRR
FT                   IYEAGYLGVSWPKEYGGWGENPIKEIIVREEFAKAGVPYATVGLGVSVVGPAIILNGTE
FT                   EQKRKYIRRILTAEDIWCQGFSEPQAGSDLAGIKTKAEDKGDHFLVNGQKIWSSYAHLA
FT                   NYCLLLTRTGDVSERHKGLTMLIVDMKSEGIRVSPIKQITGRSEFNTLYFNNVKVPKEN
FT                   VVGKVGEGWKVAMSTLNYERLNIGTILFTVERLIRELSINNEELFNTAEDIVALKSFYK
FT                   RILERLKKGYVAGPEAAVIKLVASEAIQRVYENGVTNAGIEGLVMENGAGFRPEIIYGL
FT                   LASRAITIAGGTSEILRNLLGEVVLGLPKG"
     atgagtaaaa atgaggatga attggaagag tacagaagta agataaggga gtggataagg        60
     aataatgtac cggaggagat aagctctaaa ggagatatgg ctcctcctga gatcttaagg       120
     gagtggcaaa ggagaatata tgaggcagga tatttagggg tttcttggcc aaaggaatat       180
     ggtggatggg gagaaaatcc gattaaggag ataatagtta gagaggagtt cgccaaggca       240
     ggagtacctt atgcaacagt tggattagga gtatctgtag ttggtccagc aataattctc       300
     aacggtactg aagaacagaa gaggaaatac ataaggagaa tattaacggc tgaggatata       360
     tggtgtcaag gtttttctga accacaagct ggttcagatt tagctggaat aaagactaaa       420
     gctgaggata agggggatca ctttctagtt aatggacaga agatatggag tagttatgca       480
     catttggcta actattgtct tcttctaact agaactggtg atgtatcgga gagacataag       540
     gggcttacta tgcttatagt tgatatgaaa agtgagggaa taagagtaag cccaataaag       600
     caaattactg ggaggtcaga atttaacaca ttgtatttta ataacgtaaa ggttcctaag       660
     gagaacgtag tcggtaaggt cggtgaagga tggaaagtgg caatgtccac gctaaattat       720
     gagaggctta acataggaac aatattattt acagtagaga ggcttataag ggaattatct       780
     attaacaatg aggaattgtt caataccgct gaggatatag tagcactaaa gtcattttat       840
     aagaggatat tggagcggct taagaaggga tatgttgcag gtccagaggc tgcagtgata       900
     aagttagtag cttcagaggc catacagaga gtttatgaaa atggagtaac taatgctgga       960
     atagaagggc tagtaatgga aaatggagct ggatttagac cagagataat atatggctta      1020
     ttagcctcta gagctataac aatagctggc gggacttcag agatattaag aaatttatta      1080
     ggagaagttg ttctaggatt accaaaagga taa                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page