(data stored in ACNUC7421 zone)

EMBL: CP001402.PE319

CP001402.PE319       Location/Qualifiers
FT   CDS_pept        complement(278913..279845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0320"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40955"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKZ0"
FT                   /protein_id="ACR40955.1"
FT                   /translation="MTIFTLKLPMQGPLKYINTYLVKDNEEGILIDTGLPTQEDVITLT
FT                   NYLKAHGYPNLVVITHYHPDHMGLVRLFKDKSDILISDREFEYIAYLVSEEYEKEMRQY
FT                   LLANGFPEEFIQKMFKNRSRFNEIIDSVNFNTVKDGDVVKFGQGQMRVLLTPGHTMGHI
FT                   CLAYDKVVFCGDHILQDITPNVSLLRLEDNPLKAYLESLDRIERLSVEQLYPAHGEPFK
FT                   DVSKRVEEIKEHHKKRLEEIKNIISVLRRANGFDIASRISWYKKWDELSTFDKQLAMGE
FT                   TLAHIKYLVEEGVIREINNTNSIYYTMSS"
     gtgacgatat ttactttaaa gttaccaatg caaggtccct taaagtacat aaacacatat        60
     ttagtaaaag ataatgaaga gggcatacta atcgatactg gactacctac tcaagaagat       120
     gtaatcactt taacaaatta tttgaaggct catggttatc caaacttagt tgtaattacc       180
     cactaccatc cagatcacat ggggctagtt agattgttta aggataagag tgacatattg       240
     atatcagata gggagttcga atatatagcc tatctggtaa gtgaagaata tgaaaaggaa       300
     atgagacaat atcttctcgc gaacggattt ccagaggagt tcattcagaa aatgtttaaa       360
     aatagaagtc gatttaacga aataattgac agcgtaaatt tcaataccgt taaggatggg       420
     gatgtggtaa aatttgggca aggacagatg agagtattat taacgcctgg tcataccatg       480
     ggacatattt gcctagccta cgacaaagta gtcttctgcg gggatcacat attgcaagac       540
     ataacgccaa atgtatcgtt attgagattg gaagataacc cattgaaggc gtatttagaa       600
     agtcttgata ggatagaaag attaagtgtt gagcaattat atccagcaca tggagagcca       660
     ttcaaagatg taagtaaaag ggtagaggaa ataaaggaac accataaaaa aaggctagag       720
     gaaataaaga atattataag tgttttgaga agggctaatg gatttgatat tgcgtctaga       780
     atttcttggt ataagaagtg ggatgaactc tctacttttg ataagcaatt ggcaatgggg       840
     gaaacattag cacatattaa atacttggtc gaagagggcg ttataaggga gataaacaac       900
     actaatagta tttattatac tatgagtagt tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page