(data stored in ACNUC7421 zone)

EMBL: CP001402.PE323

CP001402.PE323       Location/Qualifiers
FT   CDS_pept        284144..284560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40959"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKZ4"
FT                   /protein_id="ACR40959.1"
FT                   /translation="MKREGSPYDLIFLHKVNLRDGGNKAILVLPGTWSSGEQLVTTSWY
FT                   GVRYTTPDIRKFKEILVPTIAFVIERFGLQVFDSERLPPNSEVISLKGYGHLDVYTGLE
FT                   SFFHVNKNLFIFKYVKISLINDDLSRRCGLCPKG"
     atgaagagag aaggttctcc atatgacctc atattccttc acaaggtaaa tttaagagat        60
     ggtggtaata aggctatact agttcttccc ggtacatggt caagcgggga acaattagta       120
     accacaagtt ggtatggtgt acgttataca acaccagaca tcagaaaatt taaggaaata       180
     cttgtaccca ctatagcatt tgtcatcgaa aggttcggtc ttcaagtctt tgacagcgag       240
     agattacctc caaatagtga agtcatctcg ttgaagggat atggccattt ggatgtgtac       300
     actgggcttg aatccttttt tcatgttaat aaaaatcttt ttatatttaa gtatgttaag       360
     atttcattga taaacgatga tctctcacgc cgttgtgggc tatgcccaaa agggtga          417
//

If you have problems or comments...

PBIL Back to PBIL home page