(data stored in ACNUC7421 zone)

EMBL: CP001402.PE325

CP001402.PE325       Location/Qualifiers
FT   CDS_pept        complement(284763..285683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0329"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40961"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKZ6"
FT                   /protein_id="ACR40961.1"
FT                   /translation="MEVQYKFERISDNVYAFIQPNGDWFLSNTGVIIGKNYAIVVDSLT
FT                   NEKMTKQFISEIRKVTDKPIKYLINTHEHEDHLWTNHLFPNAITICHKNCREKVVEGMK
FT                   RGSNPYEKLFSTIDFSGYKYTPQEVVIDDEMRIFIDDDEVRIAYVGYAHTISDIYVYVP
FT                   NKKVVFTGDLLFSPPCTPFALMGYIQGYINTLENLANLNAEVYVAGHGEVSYDRKTLYE
FT                   SRDYLIFVRDEARKLMKNIDDPIRAAYEVNLGKYEEWISKERIIGNLARAYSELKGNPP
FT                   ASKLENIDKILIEMVKYREKKGGIK"
     atggaagttc aatataagtt cgaaaggata agtgataacg tatacgcttt cattcaacct        60
     aatggtgatt ggttcttaag caatactggg gtaataattg gtaaaaatta cgctatagta       120
     gtggattcat taacgaatga gaaaatgact aaacaattca tttctgaaat aaggaaagta       180
     acggataagc caataaagta tttgataaat actcatgaac atgaagacca tttgtggact       240
     aatcacttat tccctaacgc aataaccatt tgccataaga attgtaggga gaaggtagta       300
     gagggaatga agagagggag taatccctac gagaagttat ttagtacaat agatttttcg       360
     ggctataaat acactcccca agaagtagta attgatgatg agatgagaat atttattgat       420
     gatgatgaag ttagaatagc gtatgttggc tacgcacata cgattagtga catctacgtc       480
     tatgttccta ataaaaaggt tgtatttact ggtgacctcc tcttttctcc accttgtact       540
     ccatttgcgt taatgggtta cattcaagga tatataaata cgttagagaa cctagctaat       600
     cttaacgcag aggtttatgt agctggtcac ggtgaggtaa gttatgatag aaaaacctta       660
     tatgaatcaa gggattactt aatctttgtg agggatgagg ctagaaaact gatgaagaat       720
     attgatgatc ctattagagc tgcctatgaa gtaaatttag gcaaatatga ggaatggata       780
     agtaaggaga ggataattgg aaatttggct agagcttata gcgagttgaa gggaaatcct       840
     ccagcctcaa aattggagaa cattgataaa atattaatag agatggttaa atatagggaa       900
     aagaaaggtg ggataaaata a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page