(data stored in ACNUC7421 zone)

EMBL: CP001402.PE327

CP001402.PE327       Location/Qualifiers
FT   CDS_pept        complement(286674..287603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0331"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40963"
FT                   /db_xref="GOA:C4KKZ8"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKZ8"
FT                   /protein_id="ACR40963.1"
FT                   /translation="MPLDPQVKDLLTKINSLLPTTPLTPQEFRKVRNELFVNLFNKEKV
FT                   ELNDIRNMTISGSNGDIKIRLYFPSLKENLPAVVYYHGGGFVYGNLDTHDSVCRLISKL
FT                   SNTIVVSVDYRLAPEHKFPTQVYEAYDVVKWLANNGGKLSIDTSKIAVAGDSAGGNLSA
FT                   VVSILDRDNKDNIVKYQVLIYPVVNMLDSSPSIYNYGDGYFLTYERILWYNKQYVKDDN
FT                   DYYNPLASPVLANPHNLPPALVITAEYDPLRDQGEIYAHKLKMSGVKAISLRYNGMIHG
FT                   FVSFYEYLDVGREAIHHIASSIKKIFNY"
     atgccactgg atcctcaagt taaagatctc ctaactaaaa taaattcgtt attacctacg        60
     actcctctaa caccacaaga gttcagaaaa gtcagaaatg aactttttgt caatttgttt       120
     aataaagaga aagttgaact gaatgatatc cgtaatatga ctatttcagg aagtaatggg       180
     gatataaaaa ttagactcta ttttccaagc ctaaaggaaa acctacccgc tgtagtgtat       240
     tatcatggag gaggtttcgt ttatgggaac ttagatactc atgatagtgt atgtaggcta       300
     atttcgaaat tatcaaatac gatagtagtt tcagtggatt atagattagc tccagaacac       360
     aaattcccta cacaagttta tgaagcttat gacgttgtta agtggttggc taataatgga       420
     ggaaagttat caatagacac gtcaaaaatt gcagttgccg gtgatagtgc aggaggcaat       480
     ttgtctgcag tagttagtat tcttgataga gataataagg ataacattgt gaagtatcaa       540
     gttttaatat accctgtagt taacatgtta gattcctccc cctcaatata taattacggt       600
     gatggctatt tcctaaccta tgagagaatt ttatggtaca ataagcagta tgttaaggat       660
     gataatgact attataatcc tttagcctca cctgtgctcg ctaatccaca taaccttcct       720
     ccagcgttgg taataactgc tgagtatgat cccttaagag atcaagggga aatttacgct       780
     cataaattga agatgagtgg agtaaaggca ataagcttaa gatataacgg tatgattcac       840
     ggtttcgtga gcttttacga atatttagat gtgggaaggg aggcaataca tcatattgca       900
     tcatcaatta aaaaaatatt taactattga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page