(data stored in ACNUC7421 zone)

EMBL: CP001402.PE330

CP001402.PE330       Location/Qualifiers
FT   CDS_pept        complement(290400..290843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0334"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40966"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL01"
FT                   /protein_id="ACR40966.1"
FT                   /translation="MDFKGIFEVKKKINAVKEFLTNPKQFAECLPGLQSYEVMNNTFKA
FT                   NFKLDVSQMKIPHMSTLTALITANILEKETSVEINGNGRSAGVGIKFNIVMGLEEGEEI
FT                   TRVSWFARVDLGMLSKLLGEDNIRRIAEPNISHIINCISSKLS"
     atggatttta agggaatttt tgaggtaaag aaaaagataa acgcagttaa ggaattctta        60
     actaatccta agcagtttgc agaatgccta cctggattac agagctatga ggtaatgaat       120
     aatacattta aagcgaattt caagctagat gtgtcgcaaa tgaaaatacc ccatatgagc       180
     acattaactg ccttaataac ggcaaatatc cttgaaaaag agactagtgt agagataaac       240
     ggtaacggta gatctgctgg ggttggaata aagtttaata tcgtcatggg attagaggaa       300
     ggtgaggaaa ttactagagt gagttggttt gccagggtag atcttggaat gttatctaaa       360
     cttttagggg aggacaacat tagaagaata gccgagccca atataagcca tataataaac       420
     tgtatttctt caaaattatc atga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page