(data stored in ACNUC7421 zone)

EMBL: CP001402.PE332

CP001402.PE332       Location/Qualifiers
FT   CDS_pept        292328..292924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0336"
FT                   /product="carbohydrate kinase FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40968"
FT                   /db_xref="GOA:C4KL03"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL03"
FT                   /protein_id="ACR40968.1"
FT                   /translation="MPNSFILAIDEGTTSARAIIYNQDLEIVGIGQHEFPQHYPQPGYV
FT                   EHNPHEIWNSQMLAIKEAMEKAKIEGKQITGIGVTNQRETIILWDVKSGKPIYNAIVWQ
FT                   DRRTSHTTDWLKANYFRMIKDKMGLVPDPYFSASKIKWILDNVPNAREKAERGEIKFGT
FT                   VDTYLIWKLTNGKVHITDYSNASRIVLFNESYLFR"
     gtgcctaata gcttcatctt ggcaatagat gagggaacaa caagtgctag ggcaataatc        60
     tacaatcaag atttagaaat agtaggaata ggtcaacacg agttccctca gcattatcca       120
     caaccagggt atgttgaaca taacccccat gagatatgga attcacaaat gctggccata       180
     aaggaggcaa tggaaaaggc aaagattgag ggcaagcaga ttaccggaat tggagtgacc       240
     aatcagaggg agactataat actgtgggat gtaaaaagtg gaaagccaat ttacaatgca       300
     atagtttggc aagatagaag aacttcacat acaacagatt ggctaaaggc aaattacttt       360
     aggatgatta aggataaaat ggggctagtt ccagaccctt attttagcgc atccaagata       420
     aagtggatat tggataacgt tcctaatgca agggaaaagg ccgaaagagg agaaataaag       480
     tttggaactg tagatacgta tctaatatgg aaattaacta atgggaaagt tcacataact       540
     gattattcaa acgcctcaag aatcgtgtta tttaatgaat cctatctgtt tcgttaa          597
//

If you have problems or comments...

PBIL Back to PBIL home page