(data stored in ACNUC7421 zone)

EMBL: CP001402.PE333

CP001402.PE333       Location/Qualifiers
FT   CDS_pept        complement(292895..293170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0337"
FT                   /product="sugar transport related protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40969"
FT                   /db_xref="GOA:C4KL04"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL04"
FT                   /protein_id="ACR40969.1"
FT                   /translation="MVLLVGLGFMTLLLYLGGVYKVTGGILVPYFMLFVAFEQWAGAVT
FT                   LFYPTELYPTPVRAVGQGFATEISRVGSVLGVFYFPILTKQIGFIK"
     atggtacttc tagttggatt aggtttcatg acgctattac tttatctagg aggagtttac        60
     aaggtcactg gaggaatatt agtaccatat ttcatgttgt tcgtagcctt tgaacaatgg       120
     gcaggagcag taacattatt ttatccaact gaactatatc caaccccagt tagggcggtt       180
     gggcaaggat ttgctactga aattagtaga gttggatcag tacttggcgt attttacttt       240
     ccaatattaa cgaaacagat aggattcatt aaataa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page