(data stored in ACNUC7421 zone)

EMBL: CP001402.PE337

CP001402.PE337       Location/Qualifiers
FT   CDS_pept        complement(294855..295853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0341"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40973"
FT                   /db_xref="GOA:C4KL08"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL08"
FT                   /protein_id="ACR40973.1"
FT                   /translation="MRNLAIKAINLTKRFGKSVAVDHINFEVYEGEIFGFLGPNGAGKS
FT                   TTIKMLTTVLTPSEGTAIVNGYDVIKQPAHVRQSIGVVPQEYTADEDLTGWENMMMMAG
FT                   LYGIPKKVAEERSKELLEMVELTYAVKRKVETYSGGMRRRLEIAMSLISRPKILFLDEP
FT                   TLGLDAQTRAAIWQYIMKLKEEYKMTIFVTTHYLEEADMYGDRIAIIDKGKILAIGSPK
FT                   ELKEKIGGDLVSLQTNNDELAIKVVSSIDGILNVKKANDGIRIKVRNGEEKAPEILESL
FT                   VKNGIKVSRMSITEPTMDEVYMEFTGKRLRDEEASAQEMFAFRRTMRRART"
     gtgcgtaatc tcgcgataaa agctataaat ctgactaaga gatttggaaa gtccgttgcg        60
     gttgatcaca ttaattttga agtatatgag ggtgaaatat ttggctttct aggtcctaat       120
     ggggctggga agtcaaccac aataaaaatg ttaactactg tattaacacc gtctgaagga       180
     actgcaattg ttaatggata tgatgtaata aaacagcccg cacatgttag acaatcaata       240
     ggcgtagtac cacaagaata cactgcggat gaggatttga ctggttggga aaacatgatg       300
     atgatggcag gactttacgg aataccaaag aaagtagcag aggagagatc taaggagtta       360
     cttgaaatgg ttgagttaac ttatgctgtt aagagaaaag ttgaaacgta ttctggaggt       420
     atgaggagga gattggaaat tgctatgtca ctaataagta gacctaaaat actgttctta       480
     gatgagccaa cgttaggttt agacgcgcaa actagggctg caatatggca atacataatg       540
     aagctaaagg aggaatataa gatgacaata ttcgttacca cgcactattt agaggaggct       600
     gacatgtacg gggatagaat tgcaattatt gataagggaa agattttagc aataggaagc       660
     cccaaggagt taaaggagaa gattggtggg gatttagttt cactccagac caataatgac       720
     gaattggcaa ttaaggtagt ttcctcaata gatggaatat taaatgtaaa gaaagcaaat       780
     gatggtatta gaattaaggt taggaatggt gaggagaaag ctccagagat cctagagtct       840
     ttagttaaaa atggtattaa ggttagtaga atgtcaatta ctgaaccaac aatggatgag       900
     gtatatatgg agttcactgg aaagaggctg agagatgaag aggctagcgc acaagaaatg       960
     ttcgcattta gaagaactat gaggagggcg agaacatga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page