(data stored in ACNUC7421 zone)

EMBL: CP001402.PE339

CP001402.PE339       Location/Qualifiers
FT   CDS_pept        296655..296882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0343"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40975"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL10"
FT                   /protein_id="ACR40975.1"
FT                   /translation="MGTIKFIFGKPVDEPFDRENEIRQLVEMANRRQPTAIIGVRRIGK
FT                   TSVILKGLKMVETPKVYLSAVLCGLLQFIS"
     atgggtacca taaaattcat cttcggtaaa ccagttgatg aaccttttga tagggaaaac        60
     gagataaggc aactagttga aatggcaaat agaaggcaac caactgcaat aatcggtgtg       120
     agaaggatag gaaagacttc ggtaatattg aaaggtttaa aaatggttga gactccaaaa       180
     gtctatctct ctgcagtgct ttgtgggcta cttcaattta tttcataa                    228
//

If you have problems or comments...

PBIL Back to PBIL home page