(data stored in ACNUC7421 zone)

EMBL: CP001402.PE34

CP001402.PE34        Location/Qualifiers
FT   CDS_pept        complement(31481..31957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0034"
FT                   /product="Nucleotide binding protein PINc"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40670"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR033411"
FT                   /db_xref="InterPro:IPR039907"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJF0"
FT                   /protein_id="ACR40670.1"
FT                   /translation="MHIIFDTSAFLAGLQLSLDRVYTTQEVINEIKDKYSRFNLEIAIS
FT                   SGKVIIMKPSTRSVEKVTKVLNLTKERKLSNTDISVIALALDLQPSIVFTDDLSVQNIL
FT                   KHVGIQFSSIKINKKVEKSFKFKYVCIDCKREFDIDYRECPYCGGKVVKRRIME"
     atgcatatca tatttgatac ctcagcgttt ctagctggac tacaattgtc attagataga        60
     gtctatacca cgcaggaagt cataaatgaa ataaaggata aatattctag atttaaccta       120
     gaaattgcca tatcgtccgg aaaggtaata ataatgaagc cttctacaag gagtgtggaa       180
     aaagtaacta aagtattaaa tcttaccaaa gagagaaaac tatctaatac agatatatca       240
     gtgattgcac ttgcactaga tctgcaaccg tcaatcgtat ttactgatga cttgtcagta       300
     caaaatatac ttaaacatgt tggaatacaa ttctcttcaa tcaaaatcaa taaaaaagta       360
     gaaaaatctt ttaaattcaa atatgtctgc attgactgta aaagagaatt tgacatagac       420
     tatagagagt gcccatattg tggtggaaaa gtggtaaaaa gaagaataat ggaataa          477
//

If you have problems or comments...

PBIL Back to PBIL home page