(data stored in ACNUC7421 zone)

EMBL: CP001402.PE345

CP001402.PE345       Location/Qualifiers
FT   CDS_pept        complement(301548..301919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0351"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40981"
FT                   /db_xref="GOA:C4KL16"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL16"
FT                   /protein_id="ACR40981.1"
FT                   /translation="MLEELCKIYSKFNPKLVILFGSYARGDYTSESDIDVLVVSDIFSR
FT                   DPRESFGMAYNLKFPQVMPVAMNTQVFLKKLDEGSTFILEIIEDGKILCGEKEFEREVL
FT                   ERYKKIRKRFRRKGRLWEW"
     ttgttagagg aactgtgtaa gatttattct aagtttaatc caaaactggt catattattt        60
     ggctcctatg ccagaggaga ttacactagt gagagtgata tagacgttct agtagtttcc       120
     gatatattct ctagagatcc gagagaaagc tttggtatgg cctataattt aaaatttcct       180
     caagtaatgc ctgtggcaat gaatactcag gtttttttga agaaactgga tgaaggttca       240
     acttttattc tggagattat agaagatgga aaaatactgt gcggagagaa ggaatttgaa       300
     agagaagtat tggagaggta taagaaaatt aggaagaggt ttaggagaaa gggtagactg       360
     tgggaatggt ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page