(data stored in ACNUC7421 zone)

EMBL: CP001402.PE346

CP001402.PE346       Location/Qualifiers
FT   CDS_pept        complement(301900..302292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0352"
FT                   /product="HEPN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40982"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL17"
FT                   /protein_id="ACR40982.1"
FT                   /translation="MVSRVDDWLRQAERNLRSAEINYQNELYEEACYESQQTAAKAVKA
FT                   LLSYFHKELRGHSITFLLQSSSIQIPSEILKCAQELDKHYIPSRYPDAYDQGAPADYYN
FT                   KDDADRCLNCGKRILSWVEGIVRGTV"
     atggtaagca gagttgatga ctggcttaga caagctgaga gaaatcttag atcggcggag        60
     attaattatc agaatgagct ctacgaggaa gcttgttatg agtctcaaca gactgccgcg       120
     aaagcagtta aagcgttact aagttatttt cataaagaac taaggggaca ttcgattacc       180
     tttcttttac aatcctcttc tatccaaatt cccagtgaga tattgaaatg cgctcaagag       240
     ctcgataagc attatatccc ttctcgctat cccgatgcgt atgaccaagg tgctcctgct       300
     gattattata acaaggatga tgcagataga tgtttaaatt gcggtaagag gattttatca       360
     tgggtagagg gaattgttag aggaactgtg taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page