(data stored in ACNUC7421 zone)

EMBL: CP001402.PE348

CP001402.PE348       Location/Qualifiers
FT   CDS_pept        303420..303680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0354"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40984"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL19"
FT                   /protein_id="ACR40984.1"
FT                   /translation="MSWKLKDLKGLSAPTDVKMCTVDDVVRQLKDKYKIDVEILTKIAT
FT                   DVLVKHLTEKKITIEDIKKNYSNVKDIDNIIEDILRLSGKL"
     atgagttgga aattaaaaga ccttaagggg ttatcagctc ctactgacgt taaaatgtgt        60
     acagtagatg atgtagtaag acaattaaaa gataaataca agatagatgt tgagatctta       120
     actaaaatag ccactgatgt tctggttaaa catcttacag aaaagaagat aacaatagaa       180
     gatataaaaa agaattatag taatgttaaa gatattgaca atattataga ggatatctta       240
     agattgtctg gcaagttgta a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page